Analytical Data
-
Gene name
SPSB2
- Application
-
Alternative Names
SPSB2;GRCC9;SSB2;SPRY domain-containing SOCS box Protein 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q99619
-
Expression Region
1-263aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSHMGQTALAGGSSSTPTPQALYPDLSCP EGLEELLSAPPPDLGAQRRHGWNPKDCSENIEVKEGGLYFERRPVAQSTD GARGKRGYSRGLHAWEISWPLEQRGTHAVVGVATALAPLQTDHYAALLGS NSESWGWDIGRGKLYHQSKGPGAPQYPAGTQGEQLEVPERLLVVLDMEEG TLGYAIGGTYLGPAFRGLKGRTLYPAVSAVWGQCQVRIRYLGERRAEPHS LLHLSRLCVRHNLGDTRLGQVSALPLPPAMKRYLLYQ
-
Molecular Weight
31 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SPSB2 (Sprouty-related EVH1 domain-containing protein 2) is a member of the SPSB family of proteins, which are involved in various cellular processes, including signaling pathways, cell differentiation, and the regulation of the immune response. Research into SPSB2 has gained attention due to its potential role in cancer biology, where it may influence tumor growth and metastasis by modulating key signaling pathways. Studies have shown that SPSB2 can interact with specific proteins involved in the MAPK and PI3K/Akt pathways, thereby impacting cellular proliferation and survival. Additionally, SPSB2 is implicated in the negative regulation of immune responses, making it a potential target for therapeutic interventions in autoimmune diseases and cancer. The recombinant proteins of SPSB2 are utilized in various research settings to explore its biochemical characteristics, interaction with other cellular molecules, and functional effects, providing insights into its role in health and disease. Overall, understanding the biology of SPSB2 and developing recombinant forms of the protein can lead to new therapeutic strategies in oncology and immunology, highlighting the importance of this protein in current biomedical research.
