Analytical Data
-
Gene name
OR1J1
- Application
-
Alternative Names
OR1J1; Olfactory receptor 1J1; Olfactory receptor OR9-18
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NGS3
-
Expression Region
1-322 aa
-
AA Sequence
MSPENQSSVSEFLLLGLPIRPEQQAVFFALFLGMYLTTVLGNLLIMLLIQLDSHLHTPMY FFLSHLALTDISFSSVTVPKMLMNMQTQHLAVFYKGCISQTYFFIFFADLDSFLITSMAY DRYVAICHPLHYATIMTQSQCVMLVAGSWVIACACALLHTLLLAQLSFCADHIIPHYFCD LGALLKLSCSDTSLNQLAIFTAALTAIMLPFLCILVSYGHIGVTILQIPSTKGICKALST CGSHLSVVTIYYRTIIGLYFLPPSSNTNDKNIIASVIYTAVTPMLNPFIYSLRNKDIKGA LRKLLSRSGAVAHACNLNTLGG
-
Molecular Weight
35.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR1J1, a member of the olfactory receptor family, is primarily involved in the detection of volatile compounds, playing a crucial role in the sense of smell. Olfactory receptors, including OR1J1, are G protein-coupled receptors (GPCRs) that are expressed in the nasal epithelium and are responsible for the transduction of chemical signals into neural activity. Recent studies have highlighted the potential of OR1J1 beyond olfaction, suggesting its involvement in various physiological processes and its impact on human health. This has prompted researchers to investigate OR1J1's structure, function, and signaling pathways to better understand its biological roles. Recombinant OR1J1 proteins are being developed to facilitate functional assays and binding studies, providing insights into the receptor's interaction with odorants and other ligands. Additionally, exploring the polymorphisms of OR1J1 could shed light on individual differences in olfactory perception and susceptibility to certain diseases. Overall, the research on OR1J1 recombinant proteins is important for advancing our understanding of the molecular mechanisms of olfaction and may have implications for the development of therapeutic strategies for olfactory disorders and other related conditions.
