Analytical Data
-
Gene name
SPSB1
- Application
-
Alternative Names
SPSB1;SSB1;SPRY domain-containing SOCS box Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96BD6
-
Expression Region
24-233aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMQELQGLDYCKPTRLDLLLDMPPVSYDVQL LHSWNNNDRSLNVFVKEDDKLIFHRHPVAQSTDAIRGKVGYTRGLHVWQI TWAMRQRGTHAVVGVATADAPLHSVGYTTLVGNNHESWGWDLGRNRLYHD GKNQPSKTYPAFLEPDETFIVPDSFLVALDMDDGTLSFIVDGQYMGVAFR GLKGKKLYPVVSAVWGHCEIRMRYLNGLDPE
-
Molecular Weight
26 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SPSB1, or suppressor of cytokine signaling 1, is a protein that plays a crucial role in various cellular processes, including signal transduction, immune response modulation, and apoptosis. It belongs to the SPSB family, characterized by their ability to mediate protein interactions and contribute to the regulation of signaling pathways, particularly those involving cytokines and growth factors. The study of SPSB1 has gained significance due to its implications in several diseases, including cancer and autoimmune disorders. Understanding the function of SPSB1 at a molecular level can provide insights into how disruptions in its pathways lead to pathological conditions. Moreover, SPSB1's interaction with the ubiquitin-proteasome system highlights its potential as a target for therapeutic intervention. Recent research has focused on elucidating the structural and functional properties of SPSB1, with the goal of understanding its role in modulating key signaling cascades. This knowledge could pave the way for novel strategies aimed at harnessing SPSB1's function to develop targeted treatments for diseases where SPSB1 activity is compromised. Hence, the investigation of SPSB1 recombinant proteins serves as a vital stepping stone in the quest to uncover the broader implications of this protein in health and disease.











