Analytical Data
-
Gene name
DOCK5
- Application
-
Alternative Names
DOCK5；Dedicator of cytokinesis Protein 5
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H7D0
-
Expression Region
771-865aa
-
AA Sequence
RVLYLRFYGQSKDGDEFNNSIRQLFLAFNMLMDRPLEEAVKIKGAALKYL PSIINDVKLVFDPVELSVLFCKFIQSIPDNQLVRQKLNCMTKIVE
-
Molecular Weight
215 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DOCK5 (Dedicator of Cytokinesis 5) is a member of the DOCK family of proteins, which are known to function as guanine nucleotide exchange factors (GEFs) for Rho GTPases. These proteins play critical roles in various cellular processes, including cytoskeletal organization, cell migration, and proliferation. Dysregulation of DOCK5 has been implicated in numerous pathological conditions, including cancer. Specifically, research has indicated that DOCK5 contributes to the metastatic potential of tumors by modulating actin dynamics and promoting invasive behaviors. Given its significant role in cellular signaling and cancer progression, the study of DOCK5, particularly through the production and characterization of recombinant DOCK5 proteins, becomes crucial. Such studies can help elucidate the molecular mechanisms underlying its function, offering insights into potential therapeutic targets. By exploring DOCK5’s interactions with Rho GTPases and other cellular partners, researchers aim to develop a clearer understanding of its role in both normal physiology and disease states. The generation of recombinant DOCK5 proteins allows for the detailed analysis of its biochemical properties and interaction networks, ultimately advancing our understanding of how this protein influences cell behavior and contributes to cancer biology. This research may pave the way for novel strategies in cancer treatment by targeting DOCK5-related pathways.
