Analytical Data
-
Gene name
OR13C9
- Application
-
Alternative Names
OR13C9; Olfactory receptor 13C9; Olfactory receptor OR9-13
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NGT0
-
Expression Region
1-318 aa
-
AA Sequence
MEWENQTILVEFFLKGHSVHPRLELLFFVLIFIMYVVILLGNGTLILISILDPHLHTPMY FFLGNLSFLDICYTTTSIPSTLVSFLSERKTISFSGCAVQMFLGLAMGTTECVLLGMMAF DRYVAICNPLRYPIIMSKNAYVPMAVGSWFAGIVNSAVQTTFVVQLPFCRKNVINHFSCE ILAVMKLACADISGNEFLMLVATILFTLMPLLLIVISYSLIISSILKIHSSEGRSKAFST CSAHLTVVIIFYGTILFMYMKPKSKETLNSDDLDATDKIISMFYGVMTPMMNPLIYSLRN KDVKEAVKHLPNRRFFSK
-
Molecular Weight
35.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR13C9 is a member of the olfactory receptor (OR) family, which plays a crucial role in the detection of odorant molecules and is integral to the sense of smell in vertebrates. The study of OR proteins, including OR13C9, is significant not only for understanding the basic principles of olfaction but also for uncovering their potential roles in various physiological processes and disease states. Recent research has highlighted the involvement of olfactory receptors beyond traditional sensory functions, suggesting implications in developmental biology and neurological conditions. The OR13C9 protein, specifically, has been of interest because of its unique expression patterns and interactions with specific ligands that may influence both sensory perception and non-sensory roles in tissues such as the brain and lungs. Moreover, understanding the structure and function of OR13C9 can provide insights into the mechanisms of receptor activation and signal transduction. Advances in recombinant protein technology have enabled the production of OR13C9 for functional studies, allowing researchers to explore its properties and interactions in detail. This research can contribute to the development of novel therapeutic strategies targeting olfactory receptors for disorders related to olfaction and possibly other diseases.
