Analytical Data
-
Gene name
SPI1
- Application
-
Alternative Names
SPI1;Transcription factor PU.1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P17947
-
Expression Region
1-270aa
-
AA Sequence
MLQACKMEGFPLVPPPSEDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPHHVHSEFESFAENNFTELQSVQPPQLQQLYRHMELEQMHVLDTPMVPPHPSLGHQVSYLPRMCLQYPSLSPAQPSSDEEEGERQSPPLEVSDGEADGLEPGPGLLPGETGSKKKIRLYQFLLDLLRSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKGNRKKMTYQKMARALRNYGKTGEVKKVKKKLTYQFSGEVLGRGGLAERRHPPH
-
Molecular Weight
35.1kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of SPI1 recombinant proteins is essential due to their significant role in various biological functions, particularly in immune response and hematopoiesis. SPI1, also known as PU.1, is a transcription factor that is critical for the development of blood cells and is involved in the regulation of gene expression in myeloid and lymphoid lineages. Understanding its mechanisms can shed light on the pathogenesis of several conditions, including leukemia and other hematological disorders. The production of SPI1 recombinant proteins allows researchers to examine its structure and function, facilitating studies on its role in transcriptional regulation, interactions with other proteins, and its impact on cellular processes. Investigating SPI1 in different contexts, including its potential as a therapeutic target in cancers, can lead to advancements in treatment strategies. Moreover, the use of recombinant techniques enables the generation of specific mutations or fusion proteins, providing deeper insights into the functional domains of SPI1. This research is not only pivotal for basic science but also has implications for the development of novel clinical applications in the field of oncology and regenerative medicine. By characterizing the biochemical properties and biological activities of SPI1 recombinant proteins, researchers aim to elucidate their contribution to normal and aberrant cell functions, paving the way for innovative approaches to combat blood-related diseases.
