Analytical Data
-
Gene name
OR13C3
- Application
-
Alternative Names
OR13C3; Olfactory receptor 13C3; Olfactory receptor OR9-8
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NGS6
-
Expression Region
1-347 aa
-
AA Sequence
MIVQLICTVCFLAVNTFHVRSSFDFLKADDMGEINQTLVSEFLLLGLSGYPKIEIVYFAL ILVMYLVILIGNGVLIIASIFDSHFHTPMYFFLGNLSFLDICYTSSSVPSTLVSLISKKR NISFSGCAVQMFFGFAMGSTECLLLGMMAFDRYVAICNPLRYPIILSKVAYVLMASVSWL SGGINSAVQTLLAMRLPFCGNNIINHFACEILAVLKLACADISLNIITMVISNMAFLVLP LMVIFFSYMFILYTILQMNSATGRRKAFSTCSAHLTVVIIFYGTIFFMYAKPKSQDLIGE EKLQALDKLISLFYGVVTPMLNPILYSLRNKDVKAAVKYLLNKKPIH
-
Molecular Weight
38.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR13C3 is a member of the olfactory receptor gene family, specifically known for its role in the detection of various odorant molecules. This receptor, like many others in the olfactory system, is expressed in the sensory neurons of the olfactory epithelium, where it plays a critical role in the perception of smell. The investigation of OR13C3 and its recombinant protein has garnered attention due to its potential applications in understanding olfactory signaling pathways and their implications in human behavior and sensory perception. Moreover, studying OR13C3 can provide insights into the evolutionary aspects of the olfactory system across different species. The generation of recombinant OR13C3 protein enables researchers to conduct detailed analyses of its structure and function, as well as its interactions with various ligands, thereby facilitating investigations into the molecular mechanisms underlying olfaction. Furthermore, understanding the pharmacological properties of OR13C3 could aid in the development of new tools for manipulating olfactory responses, with potential therapeutic applications in addressing olfactory disorders or enhancing flavor and fragrance formulations. Overall, research on OR13C3 recombinant protein serves as a crucial step in elucidating the complexities of the olfactory system, fostering advancements in both basic science and practical applications related to sensory interactions.
