Analytical Data
-
Gene name
OR12D3
- Application
-
Alternative Names
OR12D3; Olfactory receptor 12D3; Hs6M1-27; Olfactory receptor OR6-27
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UGF7
-
Expression Region
1-316 aa
-
AA Sequence
MENVTTMNEFLLLGLTGVQELQPFFFGIFLIIYLINLIGNGSILVMVVLEPQLHSPMYFF LGNLSCLDISYSSVTLPKLLVNLVCSRRAISFLGCITQLHFFHFLGSTEAILLAIMAFDR FVAICNPLRYTVIMNPQVCILLAAAAWLISFFYALMHSVMTAHLSFCGSQKLNHFFYDVK PLLELACSDTLLNQWLLSIVTGSISMGAFFLTLLSCFYVIGFLLFKNRSCRILHKALSTC ASHFMVVCLFYGPVGFTYIRPASATSMIQDRIMAIMYSAVTPVLNPLIYTLRNKEVMMAL KKIFGRKLFKDWQQHH
-
Molecular Weight
35.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The OR12D3 protein, a member of the olfactory receptor family, has garnered attention in recent years due to its potential implications in sensory processing and neurobiology. Olfactory receptors play a crucial role in the detection of odorants, contributing to the complex mechanisms of smell. Despite the significance of these receptors, the functional characterization of OR12D3 remains limited. Recent studies have indicated that specific olfactory receptors, including OR12D3, are not only involved in odorant recognition but also participate in various physiological processes beyond the olfactory system, such as modulating immune responses and influencing brain signaling pathways. Investigating OR12D3's structure and function is essential for understanding its role in sensory perception and its broader implications in health and disease. The development of recombinant versions of OR12D3 enables researchers to perform detailed functional assays, potentially elucidating its ligand binding properties and intracellular signaling mechanisms. Moreover, the exploration of OR12D3 may offer insights into novel therapeutic strategies for disorders linked to sensory deficits or dysregulation in receptor signaling. Therefore, understanding the biology of OR12D3 and its pathways could pave the way for advances in both sensory neuroscience and clinical applications, making it a compelling focus of modern molecular research.
