Cat: PA1000-2998

Recombinant Human CYTSB Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CYTSB

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SPECC1;CYTSB;NSP5;Cytospin-B

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q5M775-2

  • Expression Region

    458-761aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSTQEGKIIELEQKCTGILEQGRFEREKL LNIQQQLTCSLRKVEEENQGALEMIKRLKEENEKLNEFLE LERHNNNMMAKTLEECRVTL EGLKMENGSLKSHLQGEKQKATEASAVEQTAESCEVQEMLKVARAEKDLL ELSCNELRQELLKANGEIKHVSSLLAKVEKDYSYLKEICDHQAEQLSRTS LKLQEKASESDAEIKDMKETIFELEDQVEQHRAVKLHNNQLISELESSVI KLEEQKSDLE RQLKTLTKQMKEETEEWRRFQADLQTAVVVANDIKCEAQQELRTVKRK LLEEEEKNA

  • Molecular Weight

    38 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CYTSB, or Cytochrome b561, is a pivotal protein implicated in various cellular processes, particularly in the context of electron transport and redox reactions within cellular membranes. Its unique electron transfer properties make it an intriguing subject for research, especially relating to its role in the physiology of cells. Recent studies have highlighted its potential contributions to cellular responses to oxidative stress and its involvement in neurotransmitter release, suggesting broader implications for neurobiology and metabolic regulation. The exploration of CYTSB as a recombinant protein has gained substantial interest due to its potential applications in biotechnology, such as developing biosensors, targeted drug delivery systems, and therapeutic interventions for diseases characterized by oxidative damage. The ability to produce and purify CYTSB in recombinant forms opens new avenues for understanding its structure-function relationships, as well as its interactions with other biomolecules, facilitating advancements in both fundamental research and clinical applications. The comprehensive study of CYTSB thus aims to decode its mechanistic roles and explore its utility in therapeutic contexts, contributing to the broader field of protein engineering and synthetic biology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US