Analytical Data
-
Gene name
OPN1SW
- Application
-
Alternative Names
OPN1SW; BCP; Short-wave-sensitive opsin 1; Blue cone photoreceptor pigment; Blue-sensitive opsin; BOP
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P03999
-
AA Sequence
MRKMSEEEFYLFKNISSVGPWDGPQYHIAPVWAFYLQAAFMGTVFLIGFPLNAMVLVATLRYKKLRQPLNYILVNVSFGGFLLCIFSVFPVFVASCNGYFVFGRHVCALEGFLGTVAGLVTGWSLAFLAFERYIVICKPFGNFRFSSKHALTVVLATWTIGIGVSIPPFFGWSRFIPEGLQCSCGPDWYTVGTKYRSESYTWFLFIFCFIVPLSLICFSYTQLLRALKAVAAQQQESATTQKAEREVSRMVVVMVGSFCVCYVPYAAFAMYMVNNRNHGLDLRLVTIPSFFSKSACIYNPIIYCFMNKQFQACIMKMVCGKAMTDESDTCSSQKTEVSTVSSTQVGPN
-
Molecular Weight
38.28 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OPN1SW, also known as the short-wavelength sensitive opsin, is a crucial photoreceptor protein found in the human retina, primarily expressed in cone cells responsible for color vision. This protein is involved in the perception of blue light, playing a vital role in our visual system. Mutations or variations in the OPN1SW gene can lead to color vision deficiencies or retinopathies, significantly impacting individuals’ quality of life. Research into OPN1SW has gained momentum due to its implications for understanding the molecular mechanisms of color vision, as well as its potential applications in gene therapy and retinal regenerative medicine. Scientists utilize recombinant DNA technology to produce OPN1SW protein for structural and functional studies, allowing for a deeper exploration of its properties and interactions with other retinal proteins. Investigating OPN1SW not only enhances our knowledge of normal vision processes but also contributes to identifying therapeutic targets for vision disorders caused by congenital or acquired defects in phototransduction. Insights gained from OPN1SW research may pave the way for innovative strategies to restore or enhance vision, highlighting the significance of this protein in both basic and applied biomedical research.
