Analytical Data
-
Gene name
OPN5
- Application
-
Alternative Names
OPN5；GPR136；PGR12；TMEM13；Opsin-5
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6U736
-
Expression Region
1-354aa
-
AA Sequence
MALNHTALPQDERLPHYLRDGDPFASKLSWEADLVAGFYLTIIGILSTFGNGYVLYMSSRRKKKLRPAEIMTINLAVCDLGISVVGKPFTIISCFCHRWVFGWIGCRWYGWAGFFFGCGSLITMTAVSLDRYLKICYLSYGVWLKRKHAYICLAAIWAYASFWTTMPLVGLGDYVPEPFGTSCTLDWWLAQASVGGQVFILNILFFCLLLPTAVIVFSYVKIIAKVKSSSKEVAHFDSRIHSSHVLEMKLTKVAMLICAGFLIAWIPYAVVSVWSAFGRPDSIPIQLSVVPTLLAKSAAMYNPIIYQVIDYKFACCQTGGLKATKKKSLEGFRLHTVTTVRKSSAVLEIHEEWE
-
Molecular Weight
39.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OPN5, a novel opsin discovered in the non-visual photoreceptor system, has garnered significant attention in recent years due to its unique characteristics and potential applications. Originally identified in the vertebrate retina, OPN5 is a member of the G protein-coupled receptor (GPCR) family and is involved in various biological processes, including light perception, circadian rhythms, and neuroprotection. Its ability to respond to a broad spectrum of wavelengths, particularly near-infrared light, sets it apart from traditional opsins. Research has shown that OPN5 can influence cellular signaling pathways, making it a promising candidate for optogenetic tools that enable precise control of neuronal activity. Furthermore, its role in non-visual phototransduction suggests potential implications in therapeutic strategies for retinal diseases and other sensory disorders. As scientists delve deeper into the molecular mechanisms underlying OPN5 function, they are uncovering its intricate interactions with other proteins and signaling cascades, which may pave the way for innovative treatments and technologies in both neuroscience and regenerative medicine. The ongoing exploration of OPN5 not only enriches our understanding of photoreceptive systems but also highlights the broader significance of opsins in biological research and biomedicine.
