Analytical Data
-
Gene name
TARS2
- Application
-
Alternative Names
TARS2；TARSL1；Threonine--tRNA ligase. mitochondrial
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BW92
-
Expression Region
369-718aa
-
AA Sequence
EHYQEDMFAVQPPGSDRPPSSQSDDSTRHITDTLALKPMNCPAHCLMFAHRPRSWRELPLRLADFGALHRAEASGGLGGLTRLRCFQQDDAHIFCTTDQLEAEIQSCLDFLRSVYAVLGFSFRLALSTRPSGFLGDPCLWDQAEQVLKQALKEFGEPWDLNSGDGAFYGPKIDVHLHDALGRPHQCGTIQLDFQLPLRFDLQYKGQAGALERPVLIHRAVLGSVERLLGVLAESCGGKWPLWLSPFQVVVIPVGSEQEEYAKEAQQSLRAAGLVSDLDADSGLTLSRRIRRAQLAHYNFQFVVGQKEQSKRTVNIRTRDNRRLGEWDLPEAVQRLVELQNTRVPNAEEIF
-
Molecular Weight
55.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TARS2, or mitochondrial threonyl-tRNA synthetase 2, is an essential enzyme that plays a pivotal role in mitochondrial protein translation by facilitating the charging of tRNA with the amino acid threonine. Mutations in the TARS2 gene have been linked to various mitochondrial disorders, which often manifest in multi-systemic symptoms, including neurological deficits and myopathy. The study of TARS2 recombinant protein is crucial for understanding its structural and functional properties, particularly concerning how specific mutations affect enzyme activity and mitochondrial function. These insights are vital for developing potential therapeutic strategies aimed at mitigating the effects of TARS2-related mitochondrial dysfunctions. Research on TARS2 recombinant protein typically involves expressing and purifying the protein in model systems, followed by biochemical analyses to assess its activity, stability, and interactions with other mitochondrial components. By elucidating the mechanistic details of TARS2 function, scientists aim to uncover the underlying causes of the associated disorders, ultimately paving the way for genetic and therapeutic interventions that could improve patient outcomes. This research not only contributes to the broader field of mitochondrial biology but also enhances our understanding of the interplay between tRNA synthetases and mitochondrial health.
