Analytical Data
-
Gene name
SNAI2
- Application
-
Alternative Names
SNAI2;SLUG;SLUGH;Zinc finger Protein SNAI2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O43623
-
Expression Region
1-268aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMPRSFLVKKHFNASKKPNYSELDTHTV IISPYLYESYSMPVIPQPEILSSGAYSPITVWTTAAPFHAQLPNGLSPLS GYSSSLGRVSPPPPSDTSSKDHSGSESPISDEEERLQSKLSDPHAIEAEK FQCNLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYVSLGALKMH IRTHTLPCVCKICGKAFSRPWLLQGHIRTHTGEKPFSCPHCNRAFADRSN LRAHLQTHSDVKKYQCKNCSKTFSRMSLLHKHEESGCCVAH
-
Molecular Weight
32 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SNAI2, a member of the Snail family of transcription factors, plays a critical role in embryonic development and various cellular processes, including epithelial-mesenchymal transition (EMT), which is pivotal in both normal development and cancer metastasis. The reprogramming of epithelial cells into mesenchymal cells, facilitated by SNAI2, enables increased mobility and invasiveness, contributing to tumor progression and the spread of cancer cells. Numerous studies have indicated that SNAI2 is overexpressed in several cancers, linking its activity to poor prognosis and therapeutic resistance. Given these implications, researchers are increasingly focused on characterizing SNAI2's structure and function at the molecular level, investigating its regulatory mechanisms and downstream targets. Understanding SNAI2's role could reveal new therapeutic targets for inhibiting cancer metastasis and improving treatment strategies. Consequently, the production and characterization of recombinant SNAI2 protein have become essential for elucidating its biochemical properties and interactions within cellular pathways, which could lead to novel insights into its role in pathology and potential applications in targeted therapies.
