Cat: PA1000-2961

Recombinant Human SNAI2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SNAI2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SNAI2;SLUG;SLUGH;Zinc finger Protein SNAI2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O43623

  • Expression Region

    1-268aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMPRSFLVKKHFNASKKPNYSELDTHTV IISPYLYESYSMPVIPQPEILSSGAYSPITVWTTAAPFHAQLPNGLSPLS GYSSSLGRVSPPPPSDTSSKDHSGSESPISDEEERLQSKLSDPHAIEAEK FQCNLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYVSLGALKMH IRTHTLPCVCKICGKAFSRPWLLQGHIRTHTGEKPFSCPHCNRAFADRSN LRAHLQTHSDVKKYQCKNCSKTFSRMSLLHKHEESGCCVAH

  • Molecular Weight

    32 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SNAI2, a member of the Snail family of transcription factors, plays a critical role in embryonic development and various cellular processes, including epithelial-mesenchymal transition (EMT), which is pivotal in both normal development and cancer metastasis. The reprogramming of epithelial cells into mesenchymal cells, facilitated by SNAI2, enables increased mobility and invasiveness, contributing to tumor progression and the spread of cancer cells. Numerous studies have indicated that SNAI2 is overexpressed in several cancers, linking its activity to poor prognosis and therapeutic resistance. Given these implications, researchers are increasingly focused on characterizing SNAI2's structure and function at the molecular level, investigating its regulatory mechanisms and downstream targets. Understanding SNAI2's role could reveal new therapeutic targets for inhibiting cancer metastasis and improving treatment strategies. Consequently, the production and characterization of recombinant SNAI2 protein have become essential for elucidating its biochemical properties and interactions within cellular pathways, which could lead to novel insights into its role in pathology and potential applications in targeted therapies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US