Analytical Data
-
Gene name
Smad4
- Application
-
Alternative Names
SMAD4;DPC4;MADH4;Mothers against decapentaplegic homolog 4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NPI6
-
Expression Region
1-582aa
-
AA Sequence
MEALSRAGQEMSLAALKQHDPYITSIADLTGQVALYTFCPKANQWEKTDIEGTLFVYRRSASPYHGFTIVNRLNMHNLVEPVNKDLEFQLHEPFLLYRNASLSIYSIWFYDKNDCHRIAKLMADVVEEETRRSQQAARDKQSPSQANGCSDHRPIDILEMLSRAKDEYERNQMGDSNISSPGLQPSTQLSNLGSTETLEEMPSGSQDKSAPSGHKHLTVEELFGTSLPKEQPAVVGLDSEEMERLPGDASQKEPNSFLPFPFEQLGGAPQSETLGVPSAAHHSVQPEITTPVLITPASITQSNEKHAPTYTIPLSPVLSPTLPAEAPTAQVPPSLPRNSTMMQAVKTTPRQRSPLLNQPVPELSHASLIANQSPFRAPLNVTNTAGTSLPSVDLLQKLRLTPQHDQIQTQPLGKGAMVASFSPAAGQLATPESFIEPPSKTAAARVAASASLSNMVLAPLQSMQQNQDPEVFVQPKVLSSAIQVAGAPLVTATTTAVSSVLLAPSVFQQTVTRSSDLERKASSPSPLTIGTPESQRKPSIILSKSQLQDTLIHLIKNDSSFLSTLHEVYLQVLTKNKDNHNL
-
Molecular Weight
67.3kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Smad4 protein plays a crucial role in the transforming growth factor-beta (TGF-β) signaling pathway, which is essential for various cellular processes, including cell growth, differentiation, and apoptosis. Smad4 functions as a central mediator that transduces signals from TGF-β receptors to the nucleus, where it influences gene expression and cellular responses. The study of Smad4 recombinant protein is significant due to its implications in cancer biology, as mutations or loss of Smad4 are commonly associated with pancreatic and colorectal cancers. Understanding the structure and function of Smad4 through recombinant protein techniques can provide insights into its tumor suppressor role and facilitate the development of targeted therapies. Additionally, investigating the interactions of Smad4 with other proteins within the TGF-β pathway may pave the way for novel therapeutic strategies to counteract malignancies where this signaling is dysregulated. The production and characterization of recombinant Smad4 protein allow researchers to explore its biochemical properties, post-translational modifications, and potential as a biomarker for tumor progression. As such, the research into Smad4 recombinant protein is pivotal in both fundamental biology and clinical applications, offering a pathway to understanding how modulation of this pathway could impact cancer treatment and patient outcomes.
