Analytical Data
-
Gene name
DIABLO
- Application
-
Alternative Names
DIABLO;SMAC;Diablo IAP-binding mitochondrial Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NR28
-
Expression Region
56-239aa
-
AA Sequence
AVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED
-
Molecular Weight
47.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The DIABLO protein, also known as Smac (Second Mitochondria-derived Activator of Caspases), has emerged as a critical component in the study of apoptosis, particularly in the context of cancer biology. Discovered as a mitochondrial protein released into the cytosol during apoptosis, DIABLO acts as a potent inhibitor of inhibitor of apoptosis proteins (IAPs), thereby promoting the activation of caspases and facilitating programmed cell death. Understanding the regulatory mechanisms of DIABLO and its interactions with IAPs provides insights into the dysfunctional apoptotic pathways often observed in cancer cells, which evade cell death and contribute to tumor progression and resistance to therapies. Researchers are interested in the potential of DIABLO as a therapeutic target or biomarker due to its pivotal role in modulating apoptosis. Additionally, studies investigating the structural characteristics of DIABLO, its signaling pathways, and its functional role in various cellular conditions have significant implications for developing innovative cancer treatments, including the design of DIABLO-based drugs or mimetics that can restore apoptotic sensitivity in resistant tumors. This growing body of research underscores the importance of DIABLO in the broader context of cancer treatment, as well as its potential applications in enhancing the efficacy of existing therapies by overcoming apoptosis resistance.
