Analytical Data
-
Gene name
NUDT8
- Application
-
Alternative Names
FLJ41567; Nucleoside diphosphate linked moiety X motif 8; Nucleoside diphosphate linked moiety X motif 8 mitochondrial; Nucleoside diphosphate-linked moiety X motif 8. mitochondrial; Nudix (nucleoside diphosphate linked moiety X) type motif 8; Nudix motif 8; Nudix type motif 8; NUDT 8; NUDT8; NUDT8_HUMAN
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8WV74
-
Expression Region
1-140 aa
-
AA Sequence
MLPDCLSAEGELRCRRLLAGATARLRARPASAAVLVPLCSVRGVPALLYTLRSSRLTGRHKGDVSFPGGKCDPADQDVVHTALRETREELGLAVPEEHVWGLLRPVYDPQKATVVPVLAGVGPLDPQSLRPNSEEVSWGI
-
Molecular Weight
41.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NUDT8, a member of the Nudix hydrolase family, has garnered significant attention in recent years due to its potential roles in cellular metabolism and signaling. This enzyme is known to hydrolyze nucleoside diphosphate sugars, influencing various physiological processes, including nucleotide metabolism and cell signaling pathways. Researchers have focused on NUDT8 due to its implications in cancer biology, as alterations in its activity may affect tumorigenesis and cancer progression. Additionally, NUDT8 is believed to play a crucial role in regulating intracellular levels of nucleotide pools, which are essential for DNA/RNA synthesis and repair, thus impacting overall cell health and function. Recent studies have also suggested that NUDT8 may be involved in the response to oxidative stress, further emphasizing its importance in maintaining cellular homeostasis. The investigation of NUDT8 and its recombinant protein forms aims to elucidate its biochemical properties, functional mechanisms, and potential therapeutic applications, particularly in the context of cancer treatment and metabolic disorders. Understanding the nuances of NUDT8 activity could lead to novel insights into the regulation of nucleotide metabolism and offer new avenues for therapeutic interventions in diseases characterized by disrupted cellular signaling and metabolism. As such, NUDT8 represents a promising target for further research in molecular biology and therapeutic development.
