Cat: PA2000-1226

Recombinant Human IL15Ra Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IL15Ra

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    IL15Ra;Interleukin-15 receptor subunit alpha

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q13261

  • Expression Region

    31-130aa

  • AA Sequence

    ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKA TNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPA

  • Molecular Weight

    37 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

IL15Ra, or Interleukin-15 receptor alpha, is a critical component of the IL-15 signaling pathway, which plays a fundamental role in immune regulation, particularly in the proliferation and activation of natural killer (NK) cells and CD8+ T cells. Research into IL15Ra has gained significant attention due to its potential therapeutic implications in cancer immunotherapy, where enhancing immune responses against tumors is crucial. Recombinant IL15Ra proteins have been developed to investigate their ability to enhance IL-15 activity, promoting improved immune cell function and survival. This is particularly relevant in the context of developing novel treatments for various malignancies, as well as in understanding autoimmune disorders, where dysregulation of IL-15 signaling can contribute to pathogenesis. Furthermore, IL15Ra has shown promise as a potential target for enhancing vaccine responses. By creating recombinant forms of IL15Ra, researchers aim to elucidate the molecular mechanisms underlying its function and to evaluate its efficacy in clinical applications, including as a solitary agent or in combination with other immunotherapeutic strategies. These studies are paving the way for innovative treatments that harness the power of the immune system to combat disease more effectively.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US