Cat: PA1000-2919

Recombinant Human SHH Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SHH

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SHH;Sonic hedgehog Protein

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q15465

  • Expression Region

    24-197aa

  • AA Sequence

    CGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKISRNSERF KELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLR VTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWV YYESKAHIHCSVKAENSVAAKSGG

  • Molecular Weight

    51 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SHH (Sonic Hedgehog) is a crucial signaling protein that plays a vital role in embryonic development and tissue patterning. First identified in Drosophila, its mammalian counterpart has been extensively studied for its involvement in key processes such as cell proliferation, differentiation, and organogenesis. Aberrations in SHH signaling pathways have been linked to various developmental disorders and cancers, making it a significant focus of research in developmental biology and oncology. The recombinant SHH protein is often produced to study its functional mechanisms and refine therapeutic approaches. By utilizing techniques like molecular cloning and protein expression systems, researchers aim to generate high-purity SHH proteins. This allows for detailed investigations into SHH's interactions with receptors, downstream signaling cascades, and its effects on cell behavior. Understanding SHH dynamics not only sheds light on fundamental biological processes but also aids in the development of targeted treatments for SHH-related pathologies, enhancing our capacity to address congenital abnormalities and malignancies associated with disrupted hedgehog signaling.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US