Analytical Data
-
Gene name
SHH
- Application
-
Alternative Names
SHH;Sonic hedgehog Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q15465
-
Expression Region
24-197aa
-
AA Sequence
CGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKISRNSERF KELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLR VTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWV YYESKAHIHCSVKAENSVAAKSGG
-
Molecular Weight
51 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SHH (Sonic Hedgehog) is a crucial signaling protein that plays a vital role in embryonic development and tissue patterning. First identified in Drosophila, its mammalian counterpart has been extensively studied for its involvement in key processes such as cell proliferation, differentiation, and organogenesis. Aberrations in SHH signaling pathways have been linked to various developmental disorders and cancers, making it a significant focus of research in developmental biology and oncology. The recombinant SHH protein is often produced to study its functional mechanisms and refine therapeutic approaches. By utilizing techniques like molecular cloning and protein expression systems, researchers aim to generate high-purity SHH proteins. This allows for detailed investigations into SHH's interactions with receptors, downstream signaling cascades, and its effects on cell behavior. Understanding SHH dynamics not only sheds light on fundamental biological processes but also aids in the development of targeted treatments for SHH-related pathologies, enhancing our capacity to address congenital abnormalities and malignancies associated with disrupted hedgehog signaling.











