Cat: PA1000-2918

Recombinant Human SHC1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SHC1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SHC1;SHC;SHCA;SHC-transforming Protein 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P29353

  • Expression Region

    1-474aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHFNTRTQVTREAISLVCEAVPGAKGATRRRK PCSRPLSSILGRSNLKFAGMPITLTVSTSSLNLMAADCKQIIANHHMQSI SFASGGDPDTMNKLSGGGGRRTRVEGGQLGGEEWTRHGSFVNKPTRGWLH PNDKVMGPGVSYLVRYMGCVEVLQSMRALDAEYVAYVAKDPVNQRACHIL ECPEGLAQDVISTIGQAFELRFKQYLRNPPKLVTPHDRMAGFDGSAWDEE EEEPPDHQYYNDFPGKEPPLGGVVDMRLREGAAPGAARPTAPNAQTPSHL GATLPVGQPVGGDPEVRKQMPPPPPCPAGRELFDDPSYVNVQNLDKARQA VGGAGPPNPAINGSAPRDLFDMKPFEDALRVPPPPQSVSMAEQLRGEPWF HGKLSRREAEALLQLNGDFLVRESTTTPGQYVLTGLQSGQPKHLLLVDPE GVVRTKDHRFESVSHLISYHMDNHLPIISAGSELCLQQPVERKL

  • Molecular Weight

    54 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SHC1, a crucial player in cellular signaling, is a member of the SHC family of proteins that serve as adapters for various growth factor receptors and intracellular signaling pathways. Its role in mediating cell proliferation, differentiation, and survival has made it a subject of intense scientific research, particularly in the context of cancer and metabolic diseases. The SHC1 protein contains specific domains, such as the Src homology 2 (SH2) domain and phosphotyrosine-binding (PTB) domain, which facilitate interactions with phosphorylated proteins, thereby activating downstream signaling cascades like the Ras-MAPK pathway. Dysregulation of SHC1 has been linked to tumorigenesis and poor prognosis in several types of cancer, including breast, colorectal, and prostate cancers. Consequently, understanding the structure, function, and regulatory mechanisms of SHC1 and its interactions with other signaling molecules is vital for developing targeted therapeutic strategies. Recent advances in recombinant protein technology have enabled the production of SHC1 in a form suitable for structural and functional studies, paving the way for enhanced understanding of its role in health and disease. These studies aim to elucidate the molecular mechanisms underlying SHC1 function and its potential as a biomarker or therapeutic target, thus contributing to the broader field of cancer biology and personalized medicine.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US