Cat: PA1000-2913

Recombinant Human SH3GL2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SH3GL2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SH3GL2;CNSA2;SH3D2A;Endophilin-A1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q99962

  • Expression Region

    1-352aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSHMSVAGLKKQFHKATQKVSEKVGGAEG TKLDDDFKEMERKVDVTSRAVMEIMTKTIEYLQPNPASRAKLSMINTMSK IRGQEKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMRELSE VKDSLDIEVKQNFIDPLQNLHDKDLREIQHHLKKLEGRRLDFDYKKKRQG KIPDEELRQALEKFDESKEIAESSMFNLLEMDIEQVSQLSALVQAQLEYH KQAVQILQQVTVRLEERIRQASSQPRREYQPKPRMSLEFPTGDSTQPNGG LSHTGTPKPSGVQMDQPCCRALYDFEPENEGELGFKEGDIITLTNQIDEN WYEGMLHGHSGFFPINYVEILVALPH

  • Molecular Weight

    43 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SH3GL2, a gene encoding a protein involved in endocytosis and intracellular trafficking, has garnered attention in recent years due to its role in cell membrane dynamics and signal transduction. This protein is particularly significant in the context of various cellular processes, including the regulation of synaptic vesicle recycling and the modulation of receptor-mediated endocytosis. Mutations and dysregulation of SH3GL2 have been implicated in several pathological conditions, including neurological disorders and cancer, highlighting its potential as a therapeutic target. Researchers have focused on the production of recombinant SH3GL2 protein to facilitate the study of its structure and function. Understanding its interactions with other cellular components, such as clathrin and dynamin, may provide insights into the mechanisms underlying endosomal trafficking and the cellular responses to external stimuli. Given the increasing interest in membrane dynamics and their implications in disease, the recombinant SH3GL2 protein serves as a valuable tool for elucidating the functional roles of this protein in both health and disease, paving the way for future therapeutic strategies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US