Analytical Data
-
Gene name
AP3b1
- Application
-
Alternative Names
AP3b1；ADTB3A；AP-3 complex subunit beta-1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O00203
-
Expression Region
944-1094aa
-
AA Sequence
SITVSMGIDFCDSTQTASFQLCTKDDCFNVNIQPPVGELLLPVAMSEKDFKKEQGVLTGMNETSAVIIAAPQNFTPSVIFQKVVNVANVGAVPSGQDNIHRFAAKTVHSGSLMLVTVELKEGSTAQLIINTEKTVIGSVLLRELKPVLSQG
-
Molecular Weight
16 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
AP3B1, a gene encoding the beta subunit of the adaptor protein complex 3 (AP-3), plays a critical role in intracellular trafficking, particularly in the sorting of proteins to lysosomes and lysosome-related organelles. This complex is essential for the transport of transmembrane proteins and soluble cargo, impacting various cellular functions. Mutations in the AP3B1 gene have been linked to a rare disorder known as Hermansky-Pudlak Syndrome, characterized by oculocutaneous albinism, platelet storage pool deficiency, and lung fibrosis, which highlights the importance of AP3B1 in cellular health and disease. Researchers are increasingly focused on characterizing AP3B1 recombinant proteins to better understand their structure and function, elucidating the mechanisms of intracellular transport and the pathogenesis of associated disorders. Understanding AP3B1 is crucial for developing targeted therapies and interventions for diseases related to protein trafficking defects. Consequently, investigations into AP3B1 recombinant proteins are expected to offer insights into cellular dynamics and potentially pave the way for novel treatments for genetic conditions linked to dysfunctional cellular transport mechanisms.
