Cat: PA2000-1217

Recombinant Human AP3b1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    AP3b1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    AP3b1;ADTB3A;AP-3 complex subunit beta-1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O00203

  • Expression Region

    944-1094aa

  • AA Sequence

    SITVSMGIDFCDSTQTASFQLCTKDDCFNVNIQPPVGELLLPVAMSEKDFKKEQGVLTGMNETSAVIIAAPQNFTPSVIFQKVVNVANVGAVPSGQDNIHRFAAKTVHSGSLMLVTVELKEGSTAQLIINTEKTVIGSVLLRELKPVLSQG

  • Molecular Weight

    16 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

AP3B1, a gene encoding the beta subunit of the adaptor protein complex 3 (AP-3), plays a critical role in intracellular trafficking, particularly in the sorting of proteins to lysosomes and lysosome-related organelles. This complex is essential for the transport of transmembrane proteins and soluble cargo, impacting various cellular functions. Mutations in the AP3B1 gene have been linked to a rare disorder known as Hermansky-Pudlak Syndrome, characterized by oculocutaneous albinism, platelet storage pool deficiency, and lung fibrosis, which highlights the importance of AP3B1 in cellular health and disease. Researchers are increasingly focused on characterizing AP3B1 recombinant proteins to better understand their structure and function, elucidating the mechanisms of intracellular transport and the pathogenesis of associated disorders. Understanding AP3B1 is crucial for developing targeted therapies and interventions for diseases related to protein trafficking defects. Consequently, investigations into AP3B1 recombinant proteins are expected to offer insights into cellular dynamics and potentially pave the way for novel treatments for genetic conditions linked to dysfunctional cellular transport mechanisms.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US