Analytical Data
-
Gene name
UCP3
- Application
-
Alternative Names
UCP3；SLC25A9；Putative mitochondrial transporter UCP3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P55916
-
Expression Region
181-214aa
-
AA Sequence
GTLPNIMRNAIVNCAEVVTYDILKEKLLDYHLLT
-
Molecular Weight
34.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
UCP3, or uncoupling protein 3, is a member of the mitochondrial transporter protein family that plays a vital role in regulating energy balance and thermogenesis in mammals. It is primarily expressed in skeletal muscle and brown adipose tissue, where it is thought to facilitate the dissipation of protons across the inner mitochondrial membrane, thereby reducing the production of ATP and generating heat instead. This function is particularly pertinent in the context of obesity and metabolic disorders, as UCP3 has been implicated in the mechanisms of energy expenditure and the regulation of fatty acid metabolism. Research into UCP3 recombinant protein has expanded our understanding of its physiological roles and potential therapeutic applications. By producing UCP3 as a recombinant protein, scientists can study its structure-function relationships, interactions with other mitochondrial proteins, and effects on mitochondrial bioenergetics in detail. Additionally, examining the effects of UCP3 overexpression or knockdown in various cellular models provides insights into its role in metabolic health and disease. This research is increasingly relevant in the face of rising global obesity rates and associated metabolic syndromes, highlighting UCP3's potential as a target for novel interventions aimed at enhancing energy expenditure and combating metabolic diseases. Overall, the study of UCP3 recombinant protein contributes significantly to our understanding of mitochondrial biology and its implications for human health.
