Cat: PA1000-2894

Recombinant Human SERTAD2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SERTAD2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SERTAD2;KIAA0127;TRIPBR2;SERTA domain-containing Protein 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q14140

  • Expression Region

    1-314aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMLGKGGKRKFDEHEDGLEGKIVSPCDG PSKVSYTLQRQTIFNISLMKLYNHRPLTEPSLQKTVLINNMLRRIQEELK QEGSLRPMFTPSSQPTTEPSDSYREAPPAFSHLASPSSHPCDLGSTTPLE ACLTPASLLEDDDDTFCTSQAMQPTAPTKLSPPALLPEKDSFSSALDEIE ELCPTSTSTEAATAATDSVKGTSSEAGTQKLDGPQESRADDSKLMDSLPG NFEITTSTGFLTDLTLDDILFADIDTSMYDFDPCTSSSGTASKMAPVSAD DLLKTLAPYSSQPVTPSQPFKMDLTELDHIMEVLVGS

  • Molecular Weight

    36 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SERTAD2 (SERTA domain containing 2) is a protein that plays a crucial role in various cellular processes, including cell proliferation, differentiation, and response to stress. As a member of the SERTAD family, SERTAD2 is known to interact with specific transcription factors and modulate their activity, thereby influencing gene expression and developmental pathways. Recent studies have implicated SERTAD2 in several key biological functions, including tumorigenesis, making it a significant focus of cancer research. Its involvement in signaling pathways associated with cell cycle regulation and apoptosis suggests that SERTAD2 could serve as a potential biomarker for certain cancers. Moreover, understanding the molecular mechanisms by which SERTAD2 exerts its functions may offer novel therapeutic targets for interventions in cancer and other diseases. The recombinant production of SERTAD2 enables detailed structural and functional analyses, paving the way for advanced studies on its interactions and regulatory roles in various physiological contexts. As the understanding of SERTAD2 expands, it may reveal further insights into its contributions to cellular homeostasis and disease progression, highlighting its potential as a target for future therapeutic strategies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US