Analytical Data
-
Gene name
DLG1
- Application
-
Alternative Names
DLG1；Disks large homolog 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q12959
-
Expression Region
1-90aa
-
AA Sequence
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALI DIQEFYEVTLLDNPKCIDRSKPSEPIQPVNTWEISSLPSS
-
Molecular Weight
36 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DLG1 (Discs Large Homolog 1) is a critical member of the MAGUK (membrane-associated guanylate kinase) family, playing a pivotal role in cell signaling, synaptic structure, and cellular junctions. The protein is mainly localized at the postsynaptic density of neurons, where it interacts with various signaling molecules, scaffolding proteins, and receptors, thereby influencing synaptic stability and plasticity. Research has shown that DLG1 is involved in several neurological processes and may be linked to neurodevelopmental disorders and pathologies such as schizophrenia and autism spectrum disorders. The investigation of DLG1 as a recombinant protein has gained traction due to its significance in understanding synaptic functions and the molecular mechanisms underlying synaptic transmission. Researchers aim to produce and characterize DLG1 to elucidate its structural properties, functional interactions, and regulatory mechanisms. Moreover, recombinant DLG1 offers a platform for studying potential therapeutic interventions targeting synaptic dysfunctions. By employing techniques such as protein crystallography, biophysical assays, and cellular models, scientists are working to define the role of DLG1 in health and disease, potentially paving the way for novel approaches in treating synaptic-related disorders. The focus on DLG1 in basic and applied research underscores its importance in neuroscience, with the potential to enhance our understanding of complex neurobiological systems.
