Cat: PA2000-9769

Recombinant Human NPIP Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    NPIP

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    NPIP

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    A6NHP6

  • Expression Region

    1-128  aa

  • AA Sequence

    MVDGQPSLQQVLERVDEWMAKEGLLDPNVKSIFVTCGDWDLKVMLPGQCQYLGLPVADYFKQWINLKKAYSFAMGCWPKNGLLDMNKGLSLQHIGRPHSGIDDCKNIANIMKTLAYRGFIFKQTSKPF

  • Molecular Weight

    40.9 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

NPIP (Nuclear Protein Interactor of Serine/Arginine-rich Splicing Factors) is a group of proteins that have garnered interest due to their significant roles in various cellular processes, including RNA splicing, transcription regulation, and the DNA damage response. Recent studies have highlighted the multifunctional nature of NPIPs, which are involved in the regulation of gene expression and might play critical roles in the development of diseases such as cancer. As the understanding of the molecular mechanisms underlying these processes expands, researchers are increasingly focusing on the recombinant production of NPIP proteins to elucidate their structure and function. Recombinant protein techniques enable the generation of large quantities of these proteins, facilitating in-depth biochemical and biophysical characterizations. Furthermore, this approach allows scientists to investigate NPIPs' interactions with other cellular molecules, paving the way for potential therapeutic applications. The exploration of NPIPs is particularly relevant in the context of cancer biology, where aberrant splicing and gene expression often contribute to tumorigenesis. By producing and studying NPIPs in a controlled setting, researchers aim to uncover new insights that could lead to targeted treatment strategies. Overall, the recombinant study of NPIP proteins is a crucial step toward understanding their intricate roles in cellular function and pathology, ultimately contributing to advancements in medical science and therapeutic development.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US