Analytical Data
-
Gene name
NPHP4
- Application
-
Alternative Names
KIAA0673; Nephrocystin-4; nephronophthisis 4; Nephroretinin; NPHP4; NPHP4_HUMAN; POC10; POC10 centriolar protein homolog; SLSN4
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O75161
-
Expression Region
1-81 aa
-
AA Sequence
MCGAFSTQAGAVEKTLFDISPAPGAPVGMLGEDPPVHVRCSDPNVICETQNVGPGEPRDIFLKVASGPSPEIKDFFVIIYS
-
Molecular Weight
34.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Research on NPHP4 (Nephronophthisis 4) recombinant protein has gained significant attention due to its critical role in kidney function and development. NPHP4 is one of the several genes implicated in nephronophthisis, a genetically heterogeneous disorder leading to end-stage renal disease, particularly in children and young adults. The protein encoded by NPHP4 is primarily localized in the primary cilia of renal epithelial cells and is essential for maintaining renal structure and function. Disruptions in NPHP4 lead to ciliary dysfunction, contributing to various renal pathologies. Understanding the biological mechanisms and interactions of NPHP4 is crucial for developing therapeutic strategies for nephronophthisis and related ciliopathies. Recombinant protein studies enable the elucidation of NPHP4’s structure, function, and interaction with other cellular components. Additionally, producing NPHP4 in a recombinant form allows for functional assays and high-throughput screening of potential drugs or compounds that might restore its function or mitigate the effects of its dysfunction. Overall, NPHP4 recombinant protein research is vital for advancing our understanding of kidney diseases and refining treatment options for patients affected by these debilitating conditions.
