Cat: PA2000-9767

Recombinant Human NPHP4 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    NPHP4

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    KIAA0673; Nephrocystin-4; nephronophthisis 4; Nephroretinin; NPHP4; NPHP4_HUMAN; POC10; POC10 centriolar protein homolog; SLSN4

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O75161

  • Expression Region

    1-81  aa

  • AA Sequence

    MCGAFSTQAGAVEKTLFDISPAPGAPVGMLGEDPPVHVRCSDPNVICETQNVGPGEPRDIFLKVASGPSPEIKDFFVIIYS

  • Molecular Weight

    34.9 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Research on NPHP4 (Nephronophthisis 4) recombinant protein has gained significant attention due to its critical role in kidney function and development. NPHP4 is one of the several genes implicated in nephronophthisis, a genetically heterogeneous disorder leading to end-stage renal disease, particularly in children and young adults. The protein encoded by NPHP4 is primarily localized in the primary cilia of renal epithelial cells and is essential for maintaining renal structure and function. Disruptions in NPHP4 lead to ciliary dysfunction, contributing to various renal pathologies. Understanding the biological mechanisms and interactions of NPHP4 is crucial for developing therapeutic strategies for nephronophthisis and related ciliopathies. Recombinant protein studies enable the elucidation of NPHP4’s structure, function, and interaction with other cellular components. Additionally, producing NPHP4 in a recombinant form allows for functional assays and high-throughput screening of potential drugs or compounds that might restore its function or mitigate the effects of its dysfunction. Overall, NPHP4 recombinant protein research is vital for advancing our understanding of kidney diseases and refining treatment options for patients affected by these debilitating conditions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US