Cat: PA1000-2872

Recombinant Human SEMG1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SEMG1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SEMG1;SEMG;Semenogelin-1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P04279

  • Expression Region

    24-402aa

  • AA Sequence

    QKGGSKGRLPSEFSQFPHGQKGQHYSGQKGKQQTESKGSFSIQYTYHVDA NDHDQSRKSQQYDLNALHKTTKSQRHLGGSQQLLHNKQEGRDHDKSKGHF HRVVIHHKGGKAHRGTQNPSQDQGNSPSGKGISSQYSNTEERLWVHGLSK EQTSVSGAQKGRKQGGSQSSYVLQTEELVANKQQRETKNSHQNKGHYQNV VEVREEHSSKVQTSLCPAHQDKLQHGSKDIFSTQDELLVYNKNQHQTKNL NQDQQHGRKANKISYQSSSTEERRLHYGENGVQKDVSQRSIYSQTEKLVA GKSQIQAPNPKQEPWHGENAKGESGQSTNREQDLLSHEQKGRHQHGSHGG LDIVIIEQEDDSDRHLAQHLNNDQNPLFTVDHHHHHH

  • Molecular Weight

    44 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SEMG1, or Skeletal Muscle Endurance-Related Protein 1, has garnered significant interest in the field of molecular biology and muscle physiology due to its potential role in influencing muscle function and endurance. Research indicates that SEMG1 is involved in the regulation of muscle fiber composition and adaptation to various forms of exercise, particularly endurance training. Studies have suggested that variations in the SEMG1 gene may be linked to athletic performance, making it a valuable target for understanding muscle endurance mechanisms and developing potential therapeutic strategies for muscle-related disorders. Furthermore, the expression of SEMG1 is influenced by various factors, including growth factors, cytokines, and mechanical stimuli, indicating its complex role in muscle adaptation and plasticity. As the global interest in fitness and physical performance continues to rise, elucidating the biological functions and mechanisms underlying SEMG1 could pave the way for novel insights into enhancing exercise performance, recovery, and overall muscle health. This research not only contributes to sports science but may also have broader implications for aging populations where maintaining muscle function is crucial for quality of life. Understanding SEMG1's role could ultimately lead to targeted interventions for muscle wasting conditions and better strategies for enhancing muscle endurance in both healthy individuals and those with specific muscular pathologies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US