Analytical Data
-
Gene name
P2RX1
- Application
-
Alternative Names
P2RX1;P2X1;P2X purinoceptor 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P51575
-
Expression Region
1-399aa
-
AA Sequence
MARRFQEELAAFLFEYDTPRMVLVRNKKVGVIFRLIQLVVLVYVIGWVFLYEKGYQTSSGLISSVSVKLKGLAVTQLPGLGPQVWDVADYVFPAQGDNSFVVMTNFIVTPKQTQGYCAEHPEGGICKEDSGCTPGKAKRKAQGIRTGKCVAFNDTVKTCEIFGWCPVEVDDDIPRPALLREAENFTLFIKNSISFPRFKVNRRNLVEEVNAAHMKTCLFHKTLHPLCPVFQLGYVVQESGQNFSTLAEKGGVVGITIDWHCDLDWHVRHCRPIYEFHGLYEEKNLSPGFNFRFARHFVENGTNYRHLFKVFGIRFDILVDGKAGKFDIIPTMTTIGSGIGIFGVATVLCDLLLLHILPKRHYYKQKKFKYAEDMGPGAAERDLAATSSTLGLQENMRTS
-
Molecular Weight
44.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
P2RX1, also known as the purinergic receptor P2X ion channel 1, is a member of the P2X receptor family, which plays a critical role in various physiological processes by mediating the effects of extracellular ATP. This receptor is widely expressed in several tissues, including the nervous system, the respiratory tract, and the immune system, where it is involved in pain perception, inflammation, and neuronal signaling. Research on P2RX1 has gained momentum due to its potential implications in various diseases, including chronic pain conditions, neurodegenerative disorders, and inflammatory diseases. The importance of investigating P2RX1 is underscored by its role as a therapeutic target; for instance, modulating its activity may provide novel strategies for pain management and inflammatory responses. Recent advancements in recombinant protein technology allow for the production of P2RX1 in a stable and functional form, enabling detailed studies of its biophysical properties, ligand-binding capabilities, and signaling mechanisms. Additionally, exploring the structure-function relationship of P2RX1 through crystallography and electrophysiological techniques can reveal insights into its gating mechanisms and potential pharmacological interventions. Overall, research on P2RX1 recombinant proteins is vital for understanding their biological functions and developing therapeutic approaches to treat a range of disorders associated with purinergic signaling.











