Analytical Data
-
Gene name
gABRb2
- Application
-
Alternative Names
gABRb2；Gamma-aminobutyric acid receptor subunit beta-2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P47870
-
Expression Region
26-244aa
-
AA Sequence
SVNDPSNMSLVKETVDRLLKGYDIRLRPDFGGPPVAVGMNIDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGDDNAVTGVTKIELPQFSIVDYKLITKKVVFSTGSYPRLSLSFKLKRNIGY
-
Molecular Weight
29.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of recombinant GABAB receptor subunit b2 (GABABR2) has gained significant attention due to its critical role in the central nervous system as a G-protein coupled receptor (GPCR) involved in inhibitory neurotransmission. GABAB receptors are pivotal for mediating the effects of the neurotransmitter gamma-aminobutyric acid (GABA), influencing various physiological processes such as mood regulation, learning, and memory. Dysfunction in GABAB signaling has been implicated in psychiatric and neurological disorders, including anxiety, depression, and epilepsy, making it a valuable target for drug development. The recombinant expression of GABABR2 facilitates the detailed study of its pharmacological properties, signaling mechanisms, and interactions with drugs. It also allows researchers to explore the receptor's structural characteristics and elucidate its role in receptor heterodimerization, specifically with the GABABR1 subunit. The advancement of recombinant DNA technology has enabled the generation of stable cell lines expressing GABABR2, allowing for high-throughput screening of potential therapeutic compounds and the development of novel pharmacological agents. Overall, research on recombinant GABABR2 is crucial for enhancing our understanding of GABAergic signaling and developing innovative treatments for related disorders.
