Cat: PA2000-1161

Recombinant Human gABRb2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    gABRb2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    gABRb2;Gamma-aminobutyric acid receptor subunit beta-2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P47870

  • Expression Region

    26-244aa

  • AA Sequence

    SVNDPSNMSLVKETVDRLLKGYDIRLRPDFGGPPVAVGMNIDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGDDNAVTGVTKIELPQFSIVDYKLITKKVVFSTGSYPRLSLSFKLKRNIGY

  • Molecular Weight

    29.3 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The study of recombinant GABAB receptor subunit b2 (GABABR2) has gained significant attention due to its critical role in the central nervous system as a G-protein coupled receptor (GPCR) involved in inhibitory neurotransmission. GABAB receptors are pivotal for mediating the effects of the neurotransmitter gamma-aminobutyric acid (GABA), influencing various physiological processes such as mood regulation, learning, and memory. Dysfunction in GABAB signaling has been implicated in psychiatric and neurological disorders, including anxiety, depression, and epilepsy, making it a valuable target for drug development. The recombinant expression of GABABR2 facilitates the detailed study of its pharmacological properties, signaling mechanisms, and interactions with drugs. It also allows researchers to explore the receptor's structural characteristics and elucidate its role in receptor heterodimerization, specifically with the GABABR1 subunit. The advancement of recombinant DNA technology has enabled the generation of stable cell lines expressing GABABR2, allowing for high-throughput screening of potential therapeutic compounds and the development of novel pharmacological agents. Overall, research on recombinant GABABR2 is crucial for enhancing our understanding of GABAergic signaling and developing innovative treatments for related disorders.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US