Analytical Data
-
Gene name
gABRb1
- Application
-
Alternative Names
gABRb1；Gamma-aminobutyric acid receptor subunit beta-1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P18505
-
Expression Region
28-136aa
-
AA Sequence
TNEPSNMPYVKETVDRLLKGYDIRLRPDFGGPPVDVGMRIDVASIDMVSE VNMDYTLTMYFQQSWKDKRLSYSGIPLNLTLDNRVADQLWVPDTYFLNDK KSFVHGVTV
-
Molecular Weight
38 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GABAB receptors, particularly the GABAB1 subunit, play a crucial role in the central nervous system by mediating inhibitory neurotransmission through the binding of the neurotransmitter gamma-aminobutyric acid (GABA). These metabotropic receptors are implicated in a wide range of physiological processes, including mood regulation, pain modulation, and learning and memory. Given their significant involvement in various neurological disorders, such as epilepsy, anxiety, and schizophrenia, there has been increasing interest in the study of GABAB1 as a potential therapeutic target. The research into recombinant GABAB1 protein facilitates the understanding of its structure, function, and interactions with other proteins, which is essential for drug discovery and the development of novel pharmacological strategies. Advances in recombinant DNA technology have enabled the production of functional GABAB1 proteins, allowing scientists to investigate their pharmacological properties, signaling mechanisms, and the effects of ligands. This research holds promise for uncovering new approaches to modulate GABAB receptor activity, thereby contributing to the treatment of various neuropsychiatric diseases. Furthermore, the exploration of GABAB1's role in receptor heterodimerization with its partner subunit GABAB2 enhances our comprehension of the receptor's overall functionality and its therapeutic potential.
