Analytical Data
-
Gene name
CAGA
- Application
-
Alternative Names
S100A8;CAGA;CFAG;MRP8;Protein S100-A8
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P05109
-
Expression Region
1-93aa
-
AA Sequence
MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CAGA, or the "Conserved Amino Acid Growth Factor," is a recombinant protein that has gained attention in various fields of biological research due to its potential roles in cellular signaling and growth regulation. The protein is derived from a conserved gene that is known to be involved in important physiological processes, including cell proliferation, differentiation, and response to stress. Studies have shown that CAGA can activate specific cellular pathways, making it a candidate for therapeutic interventions in diseases characterized by abnormal cell growth, such as cancer. Additionally, its involvement in promoting tissue regeneration and repair has sparked interest in regenerative medicine. Research on CAGA often focuses on its molecular mechanisms, including its interactions with other proteins and pathways, as well as its potential applications in biopharmaceuticals. Understanding the functional properties of CAGA through recombinant expression techniques has paved the way for in-depth studies, aiming to harness its beneficial effects in both basic and applied sciences. As advancements in molecular biology and biotechnology continue, the characterization of CAGA and its derivatives may provide novel insights into biomedical applications, further solidifying its relevance in contemporary research.
