Cat: PA1000-2823

Recombinant Human CAGA Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CAGA

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    S100A8;CAGA;CFAG;MRP8;Protein S100-A8

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P05109

  • Expression Region

    1-93aa

  • AA Sequence

    MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CAGA, or the "Conserved Amino Acid Growth Factor," is a recombinant protein that has gained attention in various fields of biological research due to its potential roles in cellular signaling and growth regulation. The protein is derived from a conserved gene that is known to be involved in important physiological processes, including cell proliferation, differentiation, and response to stress. Studies have shown that CAGA can activate specific cellular pathways, making it a candidate for therapeutic interventions in diseases characterized by abnormal cell growth, such as cancer. Additionally, its involvement in promoting tissue regeneration and repair has sparked interest in regenerative medicine. Research on CAGA often focuses on its molecular mechanisms, including its interactions with other proteins and pathways, as well as its potential applications in biopharmaceuticals. Understanding the functional properties of CAGA through recombinant expression techniques has paved the way for in-depth studies, aiming to harness its beneficial effects in both basic and applied sciences. As advancements in molecular biology and biotechnology continue, the characterization of CAGA and its derivatives may provide novel insights into biomedical applications, further solidifying its relevance in contemporary research.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US