Analytical Data
-
Gene name
S100A11
- Application
-
Alternative Names
ANXA1;ANX1;LPC1;Annexin A1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P31949
-
Expression Region
1-105aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSHMAKISSPTETERCIESLIAVFQKYAG KDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLD FSEFLNLIGGLAMACHDSFLKAVPSQKRT
-
Molecular Weight
14 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
S100A11, a member of the S100 protein family, is a small calcium-binding protein known for its involvement in various cellular processes, including cell cycle regulation, differentiation, and inflammatory responses. This protein is primarily expressed in epithelial tissues, where it plays a crucial role in maintaining homeostasis and cellular communication. Research has shown that S100A11 is associated with a variety of pathological conditions, such as cancer, where its expression levels can correlate with tumor progression and metastasis. The recombinant version of S100A11 is increasingly being explored for its potential therapeutic applications due to its ability to modulate cellular signaling pathways. Moreover, studies indicate that S100A11 can influence the behavior of immune cells and has implications in autoimmune diseases, making it a target of interest in immunological research. The production of recombinant S100A11 provides valuable insights into its structural and functional characteristics, paving the way for developing novel diagnostic and therapeutic strategies.
