Analytical Data
-
Gene name
S100A1
- Application
-
Alternative Names
S100A1;S100A;Protein S100-A1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P23297
-
Expression Region
2-94aa
-
AA Sequence
GSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS
-
Molecular Weight
26.4kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
S100A1 is a member of the S100 protein family, characterized by its calcium-binding properties and involvement in various intracellular signaling pathways. It is predominantly expressed in cardiac and skeletal muscle tissues and plays crucial roles in regulating calcium homeostasis, muscle contraction, and cellular signaling. Research has indicated that S100A1 is instrumental in heart function, as it modulates the activity of calcium channels and interacts with other proteins involved in muscle contraction. Dysregulation of S100A1 expression has been associated with several cardiovascular diseases, making it a potential therapeutic target. Recombinant S100A1 protein has been developed to facilitate detailed studies of its biochemical properties and interactions, enabling researchers to explore its functional mechanisms in health and disease. The production of this protein in a recombination system allows for a sufficient supply of purified protein for structural and functional analyses, enhancing our understanding of its role in muscle physiology and pathophysiology. This research is significant for developing novel strategies to manipulate S100A1 activity, which could lead to new interventions for heart-related disorders. Overall, S100A1 and its recombinant protein form represent a vital area of research, with implications for understanding muscle function and addressing cardiovascular health challenges.
