Analytical Data
-
Gene name
RRAS2
- Application
-
Alternative Names
RRAS2;TC21;Ras-related Protein R-Ras2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P62070
-
Expression Region
1-204aa
-
AA Sequence
MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVIF
-
Molecular Weight
50.1kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RRAS2 is a member of the Ras superfamily of GTPases, which play crucial roles in various cellular processes, including signal transduction, cell growth, and differentiation. The protein is particularly interesting due to its involvement in oncogenic pathways and its potential implications in cancer biology. Studies have shown that RRAS2 is implicated in promoting cell proliferation and survival, making it a potential target for therapeutic intervention in cancers where this protein is overexpressed. Furthermore, RRAS2 has been associated with various cellular responses to external stimuli, highlighting its role in modulating cellular behavior under stress or growth factor conditions. Research on RRAS2 has gained momentum with the advent of advanced molecular techniques that enable the detailed study of its structure, function, and regulation. Understanding the mechanistic pathways governed by RRAS2 could provide insights into novel treatment strategies for cancers and other diseases linked to dysregulated GTPase signaling. Given its relevance, the recombinant expression of RRAS2 for biochemical and biophysical characterization provides a platform to explore its interactions with downstream effectors and contribute to the broader understanding of Ras-related signaling networks. This research has the potential not only to elucidate the biological roles of RRAS2 but also to aid in the development of targeted therapies aimed at modulating its function in pathological conditions.
