Cat: PA1000-2790

Recombinant Human RRAS2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    RRAS2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    RRAS2;TC21;Ras-related Protein R-Ras2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P62070

  • Expression Region

    1-204aa

  • AA Sequence

    MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVIF

  • Molecular Weight

    50.1kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

RRAS2 is a member of the Ras superfamily of GTPases, which play crucial roles in various cellular processes, including signal transduction, cell growth, and differentiation. The protein is particularly interesting due to its involvement in oncogenic pathways and its potential implications in cancer biology. Studies have shown that RRAS2 is implicated in promoting cell proliferation and survival, making it a potential target for therapeutic intervention in cancers where this protein is overexpressed. Furthermore, RRAS2 has been associated with various cellular responses to external stimuli, highlighting its role in modulating cellular behavior under stress or growth factor conditions. Research on RRAS2 has gained momentum with the advent of advanced molecular techniques that enable the detailed study of its structure, function, and regulation. Understanding the mechanistic pathways governed by RRAS2 could provide insights into novel treatment strategies for cancers and other diseases linked to dysregulated GTPase signaling. Given its relevance, the recombinant expression of RRAS2 for biochemical and biophysical characterization provides a platform to explore its interactions with downstream effectors and contribute to the broader understanding of Ras-related signaling networks. This research has the potential not only to elucidate the biological roles of RRAS2 but also to aid in the development of targeted therapies aimed at modulating its function in pathological conditions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US