Analytical Data
-
Gene name
LY6E
- Application
-
Alternative Names
LY6E；9804；RIGE；SCA2；Lymphocyte antigen 6E
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q16553
-
Expression Region
21-101aa
-
AA Sequence
LMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKT CSPACPIPEGVNVGVASMGISCCQSFLCNFS
-
Molecular Weight
25 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LY6E is a member of the Ly-6/UPA family of proteins, which play crucial roles in immune responses and cellular signaling. Its expression is particularly noted in various immune cells, including T cells, and it has been implicated in modulating immune responses, particularly during viral infections. Recent studies have highlighted LY6E's potential as a key player in the entry of certain viruses into host cells, leading to increased interest in its structure and function. Research indicates that LY6E can influence the immune system's ability to recognize and respond to pathogens, making it a compelling target for therapeutic strategies. The development of recombinant LY6E protein has facilitated deeper investigations into its biological functions, interactions, and potential as a biomarker or therapeutic target in various diseases, including cancers and infectious diseases. With the increasing prevalence of viral infections globally, understanding the mechanisms by which LY6E operates could pave the way for novel interventions that enhance the immune system's efficacy against such threats. Therefore, investigating LY6E not only enriches our understanding of immune regulation but also holds promise for the development of innovative therapeutic approaches in immunology and virology.
