Cat: PA2000-1107

Recombinant Human BAG2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    BAG2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    BAG2;BAG family molecular chaperone regulator 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O95816

  • Expression Region

    1-211aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMAQAKINAKANEGRFCRSSSMADRSSRLLE SLDQLELRVEALREAATAVEQEKEILLEMIHSIQNSQDMRQISDGEREEL NLTANRLMGRTLTVEVSVETIRNPQQQESLKHATRIIDEVVNKFLDDLGN AKSHLMSLYSACSSEVPHGPVDQKFQSIVIGCALEDQKKIKRRLETLLRN IENSDKAIKLLEHSKGAGSKTLQQNAESRFN

  • Molecular Weight

    26 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Recombinant BAG2 protein has garnered attention in biomedical research due to its role in cellular stress response and protein homeostasis. BAG2 (Bcl-2-associated athanogene 2) is a member of the BAG family of co-chaperones, which interact with heat shock proteins to regulate critical cellular processes, including apoptosis, cell cycling, and the degradation of misfolded proteins. Its involvement in neurodegenerative diseases, cancer, and viral infections highlights its potential as a therapeutic target. The expression of BAG2 can be modulated in various cell types, making it a valuable subject for studying the molecular mechanisms underlying stress responses. By utilizing recombinant DNA technology, researchers are able to produce BAG2 in sufficient quantities to investigate its structure-function relationships and interactions with other cellular proteins. This research not only enhances our understanding of BAG2's role in health and disease but also opens avenues for developing novel therapeutic strategies targeting cellular proteostasis pathways. As such, the study of recombinant BAG2 protein presents significant implications for both fundamental biology and clinical applications.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US