Analytical Data
-
Gene name
BAG2
- Application
-
Alternative Names
BAG2；BAG family molecular chaperone regulator 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O95816
-
Expression Region
1-211aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMAQAKINAKANEGRFCRSSSMADRSSRLLE SLDQLELRVEALREAATAVEQEKEILLEMIHSIQNSQDMRQISDGEREEL NLTANRLMGRTLTVEVSVETIRNPQQQESLKHATRIIDEVVNKFLDDLGN AKSHLMSLYSACSSEVPHGPVDQKFQSIVIGCALEDQKKIKRRLETLLRN IENSDKAIKLLEHSKGAGSKTLQQNAESRFN
-
Molecular Weight
26 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Recombinant BAG2 protein has garnered attention in biomedical research due to its role in cellular stress response and protein homeostasis. BAG2 (Bcl-2-associated athanogene 2) is a member of the BAG family of co-chaperones, which interact with heat shock proteins to regulate critical cellular processes, including apoptosis, cell cycling, and the degradation of misfolded proteins. Its involvement in neurodegenerative diseases, cancer, and viral infections highlights its potential as a therapeutic target. The expression of BAG2 can be modulated in various cell types, making it a valuable subject for studying the molecular mechanisms underlying stress responses. By utilizing recombinant DNA technology, researchers are able to produce BAG2 in sufficient quantities to investigate its structure-function relationships and interactions with other cellular proteins. This research not only enhances our understanding of BAG2's role in health and disease but also opens avenues for developing novel therapeutic strategies targeting cellular proteostasis pathways. As such, the study of recombinant BAG2 protein presents significant implications for both fundamental biology and clinical applications.
