Analytical Data
-
Gene name
NDUFC2
- Application
-
Alternative Names
NDUFC2; HLC1; NADH dehydrogenase [ubiquinone] 1 subunit C2; Complex I-B14.5b; CI-B14.5b; Human lung cancer oncogene 1 protein; HLC-1; NADH-ubiquinone oxidoreductase subunit B14.5b
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O95298
-
Expression Region
1-119 aa
-
AA Sequence
MIARRNPEPLRFLPDEARSLPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRPIATAGLHRQLLYITAFFFAGYYLVKREDYLYAVRDREMFGYMKLHPEDFPEEDKKTYGEIFEKFHPIR
-
Molecular Weight
40.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NDUFC2, or NADH:ubiquinone oxidoreductase core subunit 2, is a critical component of the mitochondrial respiratory chain complex I, playing a pivotal role in cellular energy production through aerobic respiration. Its function is essential for efficient ATP generation, as it catalyzes the transfer of electrons from NADH to ubiquinone, linking the tricarboxylic acid cycle to the electron transport chain. Dysfunctions in NDUFC2 have been implicated in various mitochondrial disorders and metabolic diseases, highlighting its importance in maintaining cellular bioenergetics. Research into the recombinant expression of NDUFC2 aims to provide insights into its structural and functional characteristics, facilitating the exploration of its role in diseases and potential therapeutic interventions. Using advanced techniques in molecular biology and biochemistry, scientists can produce and purify this protein for detailed studies, including enzyme kinetics, interaction with ligands, and structure-function relationships. Additionally, understanding the regulatory mechanisms governing NDUFC2 expression could unveil novel targets for drug development, offering new avenues for the treatment of mitochondrial dysfunctions. Given the increasing prevalence of diseases associated with mitochondrial impairment, a deeper comprehension of NDUFC2 and its recombinant derivatives stands to significantly contribute to the broader field of mitochondrial research and metabolic health.
