Cat: PA1000-2740

Recombinant Human RNF34 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    RNF34

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    RNF34;E3 ubiquitin-Protein ligase RNF34

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q969K3

  • Expression Region

    1-372aa

  • AA Sequence

    MKAGATSMWASCCGLLNEVMGTGAVRGQQSAFAGATGPFRFTPNPEFSTY PPAATEGPNIVCKACGLSFSVFRKKHVCCDCKKDFCSVCSVLQENLRRCS TCHLLQETAFQRPQLMRLKVKDLRQYLILRNIPIDTCREKEDLVDLVLCH HGLGSEDDMDTSSLNSSRSQTSSFFTRSFFSNYTAPSATMSSFQGELMDG DQTSRSGVPAQVQSEITSANTEDDDDDDDEDDDDEEENAEDRNPGLSKER VRASLSDLSSLDDVEGMSVRQLKEILARNFVNYSGCCEKWELVEKVNRLY KENEENQKSYGERLQLQDEEDDSLCRICMDAVIDCVLLECGHMVTCTKCG KRMSECPICRQYVVRAVHVFKS

  • Molecular Weight

    68 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

RNF34, a member of the RING finger E3 ubiquitin ligase family, plays a crucial role in regulating various cellular processes, including protein degradation, signal transduction, and cell cycle progression. Its involvement in the ubiquitin-proteasome pathway highlights its potential impact on various diseases, including cancer and neurodegenerative disorders. Recent studies have suggested that RNF34 may modulate the stability of key regulatory proteins, influencing pathways associated with cell proliferation and apoptosis. Understanding the molecular mechanisms governing RNF34 function is essential for elucidating its role in disease contexts and may provide novel therapeutic targets. Researchers have focused on developing recombinant RNF34 proteins to study their structure, function, and interactions with other proteins. By employing techniques such as X-ray crystallography and NMR spectroscopy, scientists aim to uncover the intricate details of RNF34’s mechanism of action. Furthermore, the generation of RNF34 knockdown and overexpression models in cell lines facilitates investigations into its biological significance. As the understanding of RNF34 continues to expand, it holds promise for advancing our knowledge of ubiquitin ligases and their therapeutic potential in targeting diseases driven by aberrant protein regulation.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US