Cat: PA2000-9636

Recombinant Human NDUFA10 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    NDUFA10

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    NDUFA10; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10; mitochondrial; Complex I-42kD; CI-42kD; NADH-ubiquinone oxidoreductase 42 kDa subunit

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O95299

  • Expression Region

    1-355 aa

  • AA Sequence

    MALRLLKLAATSASARVVAAGAQRVRGIHSSVQCKLRYGMWHFLLGDKASKRLT ERSRVITVDGNICTGKGKLAKEIAEKLGFKHFPEAGIHYPDSTTGDGKPLATDY NGNCSLEKFYDDPRSNDGNSYRLQSWLYSSRLLQYSDALEHLLTTGQGVVLERS IFSDFVFLEAMYNQGFIRKQCVDHYNEVKSVTICDYLPPHLVIYIDVPVPEVQR RIQKKGDPHEMKITSAYLQDIENAYKKTFLPEMSEKCEVLQYSAREAQDSKKVV EDIEYLKFDKGPWLKQDNRTLYHLRLLVQDKFEVLNYTSIPIFLPEVTIGAHQT DRVLHQFRELPGRKYSPGYNTEVGDKWIWLK

  • Molecular Weight

    44.1kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

NDUFA10, a crucial component of the mitochondrial respiratory chain, plays a significant role in cellular energy production through oxidative phosphorylation. It is part of the NADH:ubiquinone oxidoreductase complex (Complex I), which is essential for ATP synthesis and maintaining mitochondrial function. Dysregulation or mutations in NDUFA10 can lead to various mitochondrial disorders, characterized by energy deficiency and an array of pathological features affecting multiple organ systems. Given the increasing prevalence of mitochondrial diseases and their complex genetic underpinnings, studying NDUFA10 and its recombinant protein has gained prominence. Researchers aim to understand the precise functions and mechanisms of NDUFA10 in both normal physiology and disease states. By developing and characterizing NDUFA10 recombinant proteins, scientists can explore therapeutic avenues, such as gene therapy or small molecule approaches to enhance mitochondrial function. Furthermore, studying the structural and functional aspects of the recombinant protein can provide insights into the design of drugs that target Complex I deficiencies. Overall, research on NDUFA10 recombinant protein not only contributes to a deeper understanding of mitochondrial biology but also holds potential for developing innovative strategies to address mitochondrial-related diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US