Analytical Data
-
Gene name
ITGa7
- Application
-
Alternative Names
ITGa7；Integrin alpha-7
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q13683
-
Expression Region
478-577aa
-
AA Sequence
SHEVSIAPRSIDLEQPNCAGGHSVCVDLRVCFSYIAVPSSYSPTVALDYV LDADTDRRLRGQVPRVTFLSRNLEEPKHQASGTVWLKHQHDRVCGDAMFQ
-
Molecular Weight
37 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ITGa7, also known as integrin alpha 7, is a member of the integrin family, which plays a crucial role in cell adhesion, migration, and differentiation. This transmembrane protein is primarily expressed in skeletal muscle and has been implicated in various muscle-related pathologies, including muscular dystrophies. Research has highlighted the importance of ITGa7 in the formation and maintenance of muscle fibers, as it interacts with extracellular matrix proteins, thereby influencing muscle strength and regeneration. Recent studies have focused on the potential of ITGa7 as a therapeutic target for treating muscle degenerative diseases. By understanding its structure and function, scientists aim to develop strategies to enhance its expression or mimic its activity to promote muscle repair and regeneration. The reorganization of ITGa7 proteins is of great interest for both basic research and clinical applications, as elucidating the signaling pathways and molecular mechanisms associated with ITGa7 could lead to novel therapeutic approaches for muscle-related conditions.
