Analytical Data
-
Gene name
NDST3
- Application
-
Alternative Names
NDST3; HSST3; UNQ2544/PRO4998Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 3; EC 2.8.2.8; Glucosaminyl N-deacetylase/N-sulfotransferase 3; NDST-3; hNDST-3; N-heparan sulfate sulfotransferase 3; N-HSST 3) [Includes: Heparan sulfate N-deacetylase 3; EC 3.-.-.-); Heparan sulfate N-sulfotransferase 3; EC 2.8.2.-)]
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O95803
-
Expression Region
162-259 aa
-
AA Sequence
IGFHKTSEKSVQSFQLKGFPFSIYGNLAVKDCCINPHSPLIRVTKSSKLEKGSLPGTDWTVFQINHSAYQPVIFAKVKTPENLSPSISKGAFYATIIH
-
Molecular Weight
36.52 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NDST3 (N-deacetylase/N-sulfotransferase 3) is an enzyme belonging to the NDST family, which plays a crucial role in the modification of heparan sulfate, a glycosaminoglycan involved in various biological processes. The heparan sulfate modification is essential for cell signaling, development, and tissue homeostasis. NDST3 specifically catalyzes the addition of sulfate groups to the N-acetylated glucosamine residues in heparan sulfate chains, influencing their biological activity and interactions with various signaling molecules. Abnormalities in NDST3 function have been linked to several diseases, including cancer and neurodevelopmental disorders, highlighting its potential as a therapeutic target. Researchers have increasingly focused on understanding the biochemical properties, structural characteristics, and substrate specificity of NDST3 to elucidate its role in cellular processes and disease mechanisms. Recent advances in recombinant protein technology have enabled the production of functional NDST3 for in vitro studies, facilitating investigations into its enzymatic activity and interactions with heparan sulfate precursors. This research not only enhances the understanding of NDST3's biological functions but also paves the way for the development of novel therapeutic strategies aimed at modulating heparan sulfate modifications in pathological conditions.
