Cat: PA1000-2721

Recombinant Human RhoB Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    RhoB

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    RHOB;ARH6;ARHB;Rho-related GTP-binding Protein RhoB

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P62745

  • Expression Region

    1-193aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMAAIRKKLVVVGDGACGKTCLLIVFSKDEF PEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVI LMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKDLRSDEHVRTE LARMKQEPVRTDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQ KRYGSQNGCINCC

  • Molecular Weight

    24 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

RhoB, a member of the Rho GTPase family, plays a crucial role in various cellular processes, including cytoskeletal dynamics, cell migration, and cell adhesion. As a small GTP-binding protein, RhoB is known to regulate the actin cytoskeleton and influence cellular responses to extracellular signals, which are vital for normal development and functioning of cells. Research has indicated that RhoB is involved in several pathological conditions, including cancer progression and metastasis, where its expression often becomes dysregulated. In particular, studies have shown that RhoB can act as a tumor suppressor, with its loss being associated with increased tumor growth and spread. The study of recombinant RhoB protein has gained significant interest as it enables researchers to explore its biochemical properties, signaling pathways, and functional mechanisms in a controlled environment. By producing RhoB in a recombinant form, scientists can conduct in vitro assays to dissect its interactions with downstream effectors and upstream regulators, providing insights into its role in cellular behaviors. Moreover, understanding the structure-function relationship of RhoB through recombinant protein studies can lead to potential therapeutic interventions targeting RhoB signaling pathways in diseases, particularly in cancer treatment. Overall, the study of RhoB recombinant protein is pivotal for elucidating the complex regulatory networks involving RhoB, ultimately contributing to our understanding of cellular homeostasis and potential disease mechanisms.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US