Analytical Data
-
Gene name
NDFIP2
- Application
-
Alternative Names
NDFIP2; KIAA1165; N4WBP5A; NEDD4 family-interacting protein 2; NEDD4 WW domain-binding protein 5A; Putative MAPK-activating protein PM04/PM05/PM06/PM07; Putative NF-kappa-B-activating protein 413
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NV92
-
Expression Region
1-336 aa
-
AA Sequence
MARRRSQRVCASGPSMLNSARGAPELLRGTATNAEVSAAAAGATGSEELPPGDRGCRNGG GRGPAATTSSTGVAVGAEHGEDSLSRKPDPEPGRMDHHQPGTGRYQVLLNEEDNSESSAI EQPPTSNPAPQIVQAASSAPALETDSSPPPYSSITVEVPTTSDTEVYGEFYPVPPPYSVA TSLPTYDEAEKAKAAAMAAAAAETSQRIQEEECPPRDDFSDADQLRVGNDGIFMLAFFMA FIFNWLGFCLSFCITNTIAGRYGAICGFGLSLIKWILIVRFSDYFTGYFNGQYWLWWIFL VLGLLLFFRGFVNYLKVRNMSESMAAAHRTRYFFLL
-
Molecular Weight
36.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NDFIP2, or Nedd4 family interacting protein 2, is a key regulator in cellular signaling pathways and plays a significant role in the endocytic pathway and protein degradation. It is known to interact with E3 ubiquitin ligases, primarily within the Nedd4 family, mediating the ubiquitination of various target proteins, which in turn influences cellular processes such as differentiation, immunity, and apoptosis. Research into NDFIP2 has garnered attention due to its implications in various diseases, including cancer and neurodegenerative disorders. Understanding the structure-function relationship of NDFIP2, particularly through studies involving recombinant protein technology, could provide insights into its regulatory mechanisms and interactions with other cellular proteins. The development of recombinant NDFIP2 allows for detailed biochemical characterization, analysis of interaction dynamics, and exploration of its role within cellular networks. Advancements in the production and purification of this protein have opened new avenues for studying its function in mammalian systems, making it a crucial component in uncovering the molecular underpinnings of diseases associated with dysregulated protein degradation and signaling. As research progresses, NDFIP2 is emerging as a potential therapeutic target, making its study essential for the development of novel strategies in disease intervention and treatment.
