Analytical Data
-
Gene name
SALL4
- Application
-
Alternative Names
SALL4；ZNF797；Sal-like Protein 4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UJQ4
-
Expression Region
954-1053aa
-
AA Sequence
PKEILAPSVNVDPVVWNQYTSMLNGGLAVKTNEISVIQSGGVPTLPVSLGATSVVNNATVSKMDGSQSGISADVEKPSATDGVPKHQFPHFLEENKIAVS
-
Molecular Weight
16 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SALL4 is a member of the spalt-like family of zinc-finger transcription factors, which plays a crucial role in embryonic stem cell maintenance and early development. It is primarily expressed in pluripotent stem cells, where it is involved in regulating genes associated with self-renewal and differentiation. Abnormal expression of SALL4 has been linked to several types of cancers, including germ cell tumors and leukemias, indicating its potential role as an oncogene. To better understand its functions and mechanisms, researchers have focused on the production and characterization of recombinant SALL4 protein. The recombinant protein allows for the exploration of its binding affinity to target DNA sequences, interaction with other proteins, and its impact on gene expression regulation. By studying SALL4 in vitro and in vivo, scientists aim to elucidate the pathways influenced by SALL4 and its implications in pluripotency and tumorigenesis. This research is pivotal for developing novel therapeutic strategies targeting SALL4-related pathways in cancer and regenerative medicine. Through the production of recombinant SALL4, a deeper understanding of its biological roles can be achieved, potentially paving the way for innovative treatments in regenerative biology and oncology.
