Analytical Data
-
Gene name
TL1A
- Application
-
Alternative Names
TL1A；TL1；VEGI；Tumor necrosis factor ligand superfamily member 15
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O95150
-
Expression Region
93-251aa
-
AA Sequence
DKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIP ESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPT QLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKED KTFFGAFLL
-
Molecular Weight
20 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TL1A is a member of the TNF (tumor necrosis factor) superfamily, primarily known for its role in immune regulation and inflammation. It interacts with the receptor DR3 (death receptor 3) and is involved in various cellular processes, including T-cell activation, proliferation, and cytokine production. Research has shown that TL1A is upregulated in several inflammatory diseases, such as autoimmune disorders and chronic inflammatory conditions, suggesting its potential as a therapeutic target. The study of TL1A and its recombinant protein form aims to elucidate its precise mechanisms in immune modulation and to explore its implications in disease states. Characterizing TL1A's structure and function could lead to innovative strategies for treating conditions like rheumatoid arthritis, inflammatory bowel disease, and other immune-mediated disorders, by either blocking its activity or harnessing its effects to restore immune homeostasis. As the understanding of TL1A's role in pathophysiology deepens, it presents exciting opportunities for the development of new biopharmaceuticals that could significantly impact patient care in inflammatory and autoimmune diseases.
