Analytical Data
-
Gene name
IFNa16
- Application
-
Alternative Names
IFNa16；Interferon alpha-16
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P05015
-
Expression Region
24-189aa
-
AA Sequence
CDLPQTHSLGNRRALILLAQMGRISHFSCLKDRYDFGFPQEVFDGNQFQKAQAISAFHEMIQQTFNLFSTKDSSAAWDETLLDKFYIELFQQLNDLEACVTQEVGVEEIALMNEDSILAVRKYFQRITLYLMGKKYSPCAWEVVRAEIMRSFSFSTNLQKGLRRKD
-
Molecular Weight
23.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Interferon alpha 16 (IFNa16) is a type of cytokine that plays a vital role in the immune response against viral infections and has potential therapeutic applications in cancer treatment. Unlike other interferons, IFNa16 has unique properties that may enhance its effectiveness in modulating immune responses. Research has shown that IFNa16 can activate various immune cells, including natural killer (NK) cells and T cells, leading to increased antiviral activity and antitumor effects. The production of recombinant IFNa16 has gained attention due to its potential to serve as a more effective treatment option for diseases where traditional therapies have limitations. Investigations into the mechanistic pathways influenced by IFNa16 are critical for understanding its role in immune modulation and determining how it can be best utilized in clinical settings. With advancements in biotechnology, the ability to produce IFNa16 in recombinant forms has opened new avenues for therapeutic development, making it a subject of significant interest in both immunology and oncology research. Researchers aim to elucidate the specific pathways mediated by IFNa16, explore its interactions with other cytokines, and evaluate its safety and efficacy in various disease models. The ultimate goal is to harness the potential of IFNa16 to develop novel immunotherapies that can improve patient outcomes in viral infections and cancer.
