Cat: PA1000-2675

Recombinant Human RBBP9 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    RBBP9

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    RBBP9;BOG;RBBP10;Serine hydrolase RBBP9

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O75884

  • Expression Region

    1-186aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMASPSKAVIVPGNGGGDVTTHGWYGWVKKE LEKIPGFQCLAKNMPDPITARESIWLPFMETELHCDEKTIIIGHSSGAIA AMRYAETHRVYAIVLVSAYTSDLGDENERASGYFTRPWQWEKIKANCPYI VQFGSTDDPFLPWKEQQEVADRLETKLHKFTDCGHFQNTEFHELITVVKS LLKVPA

  • Molecular Weight

    23 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

RBBP9, or Retinoblastoma Binding Protein 9, is a crucial player in various cellular processes, including cell cycle regulation, apoptosis, and transcriptional control. Its role in the regulation of gene expression and interaction with the retinoblastoma (Rb) tumor suppressor protein makes it a significant focus of cancer research, particularly in the context of tumors where Rb pathway is disrupted. Studies have shown that dysregulation of RBBP9 is associated with several types of malignancies, highlighting its potential as a biomarker for cancer diagnosis and prognosis. Additionally, RBBP9 functions within diverse molecular complexes, influencing chromatin remodeling and the modifications of histones, which are pivotal for understanding epigenetic regulation in cancer. The recombinant expression of RBBP9 allows researchers to investigate its structural and functional properties in greater detail, paving the way for potential therapeutic interventions. By developing RBBP9 as a recombinant protein, scientists can explore its interactions with other proteins and small molecules, which could lead to the identification of novel targets for cancer treatment. Overall, RBBP9 represents a compelling subject of study within the broader landscape of tumor biology and therapeutic development, necessitating further investigation into its mechanistic roles and applications in oncology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US