Analytical Data
-
Gene name
NAGPA
- Application
-
Alternative Names
Mannose 6-phosphate-uncovering enzyme; N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase; NAGPA; NAGPA_HUMAN; Phosphodiester alpha-GlcNAcase
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UK23
-
Expression Region
309-408 aa
-
AA Sequence
DNMWRCPRQVSTVVCVHEPRCQPPDCHGHGTCVDGHCQCTGHFWRGPGCDELDCGPSNCSQHGLCTETGCRCDAGWTGSNCSEECPLGWHGPGCQRPCKC
-
Molecular Weight
36.74 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NAGPA, or N-acetylglucosamine-1-phosphate acetyltransferase, is a significant enzyme involved in the biosynthesis of glycosaminoglycans and glycoproteins, crucial components in various biological processes, including cell signaling, migration, and adhesion. The study of NAGPA has gained attention due to its potential implications in understanding metabolic disorders, cancer progression, and developmental biology. Abnormalities in NAGPA function can lead to the disruption of glycosaminoglycan synthesis, resulting in various pathologies. Researchers are increasingly focused on the structural and functional characterization of NAGPA, aiming to elucidate its precise role in metabolic pathways and its interactions with other biomolecules. The reconstitution of NAGPA in a laboratory setting allows for detailed investigations into its enzymatic activity and regulation. Moreover, understanding the mechanism by which NAGPA operates could pave the way for novel therapeutic strategies targeting diseases associated with glycosaminoglycan metabolism. Identifying specific inhibitors or modulators of NAGPA might provide insights into treating conditions such as osteoarthritis, certain cancers, and genetic disorders related to glycosaminoglycan dysfunction. Overall, the research surrounding NAGPA is pivotal for advancing our comprehension of cellular processes and the development of new medical treatments.
