Analytical Data
-
Gene name
RASD2
- Application
-
Alternative Names
RASD2;TEM2;GTP-binding Protein Rhes
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96D21
-
Expression Region
1-266aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMMKTLSSGNCTLSVPAKNSYRMVVLGA SRVGKSSIVSRFLNGRFEDQYTPTIEDFHRKVYNIRGDMYQLDILDTSGN HPFPAMRRLSILTGDVFILVFSLDNRESFDEVKRLQKQILEVKSCLKNKT KEAAELPMVICGNKNDHGELCRQVPTTEAELLVSGDENCAYFEVSAKKNT NVDEMFYVLFSMAKLPHEMSPALHRKISVQYGDAFHPRPFCMRRVKEMDA YGMVSPFARRPSVNSDLKYIKAKVLREGQARERDKCTIQ
-
Molecular Weight
33 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RASD2, a member of the RAS family of small GTPases, has garnered significant attention in recent years due to its potential roles in cellular signaling and cancer biology. Unlike its well-known homologs, RASD2 predominantly functions as a GDP-bound form, acting as a negative regulator of various signaling pathways. This unique feature positions RASD2 as a critical player in modulating cellular responses to stimuli and maintaining homeostasis. Research has suggested that RASD2 is involved in processes such as neuronal differentiation, cell proliferation, and apoptosis. Moreover, its altered expression has been linked to several malignancies, indicating its potential as a biomarker and therapeutic target in cancer treatment. Understanding the structural and functional dynamics of RASD2, especially through the study of its recombinant protein, can provide insights into its regulatory mechanisms and interactions with other cellular partners. Investigating the properties of RASD2 reconstituted in vitro allows for detailed analysis of its biochemical behavior and impacts on signaling cascades. Thus, the study of RASD2 recombinant protein holds promise not only for enhancing our understanding of fundamental biological processes but also for developing novel strategies in cancer therapy and other diseases where RASD2 may play a pivotal role.
