Cat: PA1000-2667

Recombinant Human RARRES2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    RARRES2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    RARRES2;TIG2;Retinoic acid receptor responder Protein 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q99969

  • Expression Region

    21-157aa

  • AA Sequence

    ELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEFKLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFAFS

  • Molecular Weight

    31.9kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

RARRES2, also known as retinoic acid receptor responder protein 2, is a member of the retinoic acid receptor signaling pathways and has garnered increasing attention in recent years due to its potential role in various biological processes and diseases. Initially identified in the context of cancer research, RARRES2 has been implicated in tumorigenesis, with studies suggesting that it may function as a tumor suppressor in certain cancers. Beyond oncology, RARRES2 is also linked to inflammatory responses and metabolic regulation, revealing its multifaceted role in human health. The research surrounding RARRES2 involves understanding its expression patterns, molecular mechanisms, and interactions with other signaling pathways. Recombinant RARRES2 protein has been produced for functional assays to elucidate its biological roles further and explore its potential as a therapeutic target. The ongoing studies aim to clarify RARRES2’s influence on cellular processes such as apoptosis, proliferation, and differentiation, providing insights into its applications in disease modeling and drug development. Overall, the investigation of RARRES2 and its recombinant forms is crucial for expanding our knowledge of its physiological functions and therapeutic implications.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US